Без темы
<<  Магнетизм Масс-спектрометрия в протеомных исследованиях  >>
Масс-спектрометрия в протеомных исследованиях
Масс-спектрометрия в протеомных исследованиях
Белки и пептиды
Белки и пептиды
Пептидный фингерпринт
Пептидный фингерпринт
ПРОТЕОМИКА – совокупность высокотехнологичных методов изучения белков:
ПРОТЕОМИКА – совокупность высокотехнологичных методов изучения белков:
m/z
m/z
Типы ионов
Типы ионов
Источники ионов
Источники ионов
MALDI - matrix assisted laser desorption / ionization лазерная
MALDI - matrix assisted laser desorption / ionization лазерная
Пример MALDI масс-спектра: триптический гидролизат фрагмента белка М1
Пример MALDI масс-спектра: триптический гидролизат фрагмента белка М1
MALDI : типы положительных ионов и вид спектра
MALDI : типы положительных ионов и вид спектра
Естественное изотопное распределение в белках и пептидах
Естественное изотопное распределение в белках и пептидах
Замечания о ESI и MALDI:
Замечания о ESI и MALDI:
Системы разделения ионов
Системы разделения ионов
Maldi-времяпролетный масс-спектрометр с MCP детектором
Maldi-времяпролетный масс-спектрометр с MCP детектором
Уменьшение стартового разброса ионов – повышение разрешения
Уменьшение стартового разброса ионов – повышение разрешения
Разрешение и точность MALDI-TOF-MS
Разрешение и точность MALDI-TOF-MS
Распад ионов в процессе MALDI
Распад ионов в процессе MALDI
PSD (post source decay) и TOF-TOF детекция распада ионов во время
PSD (post source decay) и TOF-TOF детекция распада ионов во время
ESI – ионная ловушка с МСР детектором
ESI – ионная ловушка с МСР детектором
«Гибридные» приборы: ESI – квадруполь – ортогональный времяпролетный
«Гибридные» приборы: ESI – квадруполь – ортогональный времяпролетный
ESI - масс-спектрометры ионно-циклотронног резонанса с последующим
ESI - масс-спектрометры ионно-циклотронног резонанса с последующим
Сравнение характеристик приборов
Сравнение характеристик приборов
Историческая справка:
Историческая справка:

Презентация: «Масс-спектрометрия в протеомных исследованиях». Автор: Grachev. Файл: «Масс-спектрометрия в протеомных исследованиях.ppt». Размер zip-архива: 442 КБ.

Масс-спектрометрия в протеомных исследованиях

содержание презентации «Масс-спектрометрия в протеомных исследованиях.ppt»
СлайдТекст
1 Масс-спектрометрия в протеомных исследованиях

Масс-спектрометрия в протеомных исследованиях

Часть 1: Масс-спектрометрия

Марина Васильевна Серебрякова Лаборатория протеомного анализа ФГУ НИИ ФХМ г.Москва www.pynny.ru

2 Белки и пептиды

Белки и пептиды

Моноизотопные массы аминокислотных остатков

ADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKKFLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL

(Глутатион-трансфераза человека)

Пептидная связь

Аминокислотный остаток

3 Пептидный фингерпринт

Пептидный фингерпринт

Трипсин ( /R,K) Стафилококковая протеаза V8 ( /E)

Пептидный калькулятор GPMAW 4.04

SAPASTTQPIGSTTSTTTKTAGATPATASGLFTIPDGDFFSTARAIVASNAVATNEDLSKIEAIWKDMKVPTDTMAQAAWDLVRHCADVGSSAQTEMIDTGPYSNGISRARLAAAIKEVCTLRQFCMKYAPVVWNWMLTNNSPPANWQAQGFKPEHKFAAFDFFNGVTNPAAIMPKEGLIRPPSEAEMNAAQTAAFVKITKARAQSNDFASLDAAVTRGRITGTTTAEAVVTLPPP (Белок оболочки Х-вируса картофеля)

Num From-To MH+ HPLC pI Sequence 1 1- 19 1836.92 14,27 9,85 SAPASTTQPIGSTTSTTTK 1 1- 19 1878.93 14,27 9,85 SAPASTTQPIGSTTSTTTK 2 20- 44 2472.20 24,79 3,92 TAGATPA..PDGDFFSTAR 3 45- 60 1602.83 12,87 4,11 AIVASNAVATNEDLSK 4 61- 66 759.44 19,33 6,99 IEAIWK 5 67- 69 393.18 4,27 6,99 DMK 6 70- 84 1673.83 19,51 3,92 VPTDTMAQAAWDLVR 7 85-109 2595.13 22,48 4,34 HCADVGSS..GPYSNGISR 8 110-111 246.16 1,78 11,20 AR 9 112-117 586.39 12,82 10,10 LAAAIK 10 118-123 719.36 14,84 6,29 EVCTLR 11 124-128 655.28 17,08 8,68 QFCMK 12 129-157 3410.65 28,07 9,42 YAPVVWNWM..QGFKPEHK 13 158-176 2058.02 24,21 6,97 FAAFDFFNGVTNPAAIMPK 14 177-198 2330.18 20,92 4,60 EGLIRPPS..AAQTAAFVK 15 199-201 361.25 6,80 10,15 ITK 16 202-203 246.16 1,78 11,20 AR 17 204-218 1565.76 14,77 3,92 AQSNDFASLDAAVTR 18 219-220 232.14 2,11 11,15 GR 19 221-236 1567.86 17,90 3,15 ITGTTTAEAVVTLPPP

Num From-To MH+ HPLC pI Sequence 1 1- 56 5430.68 29,08 4,35 SAPASTTQPI…IVASNAVATNE 1 1- 56 5472.69 29,08 4,35 SAPASTTQPI…IVASNAVATNE 2 57- 62 704.38 12,90 4,11 DLSKIE 3 63- 96 3730.75 28,42 4,58 AIWKDMKVPT..ADVGSSAQTE 4 97-118 2334.22 22,73 9,58 MIDTGPYSNGISRARLAAAIKE 5 119-155 4353.07 35,01 9,02 VCTLRQFCMKY…NWQAQGFKPE 6 156-177 2452.21 24,30 7,58 HKFAAFDFFNGVTNPAAIMPKE 7 178-185 868.49 16,16 7,04 GLIRPPSE 8 186-187 219.10 1,83 3,25 AE 9 188-228 4255.19 24,38 10,52 MNAAQTAAFV…RGRITGTTTAE 10 229-236 793.48 14,07 6,96 AVVTLPPP

4 ПРОТЕОМИКА – совокупность высокотехнологичных методов изучения белков:

ПРОТЕОМИКА – совокупность высокотехнологичных методов изучения белков:

1 определение количества того или иного белка в образце 2 идентификация белка 3 уточнение первичной структуры 4 определение пост-трансляционных модификаций

ПРЕДПОСЫЛКИ: Реализация программы Геномика – быстрое секвенирование ДНК, создание баз данных нуклеотидных последовательностей Развитие инструментальных методов – масс-спектрометрия белков и пептидов, сопряжение с методами разделения

5 m/z

m/z

Масс-спектрометрия белков и пептидов

Fq = zeE

a = (z/m)eE

FL = ze[vxB]

a = (z/m)e[vxB]

Общий вопрос - что измеряется?

Масс- спектрометрия – расчет молекулярной массы ионов по их поведению в электрических и/или магнитных полях

Примеры:

Сила, действующая на ион массы m и заряда z в однородном электрическом поле:

Сила, действующая на ион массы m, заряда z, скорости v в однородном магнитном поле:

6 Типы ионов

Типы ионов

Общая схема масс-спектрометра

Источник ионов

Система разделения ионов

Детектор

Времяпролетные (TOF) Квадрупольные (Q) Ионные ловушки (IT) Ионно-циклотронного резонанса (ICR-FT)

Микроканальные пластины (MCP) Диноды Магнит (ICR-FT)

MALDI ESI

Положительные: - захват протона либо другого катиона (Na, K); - потеря электрона (катион-радикал). Отрицательные: - утрата протона; - захват электрона.

7 Источники ионов

Источники ионов

ESI – электрораспыление и ионизация

Несколько последовательных «упариваний-взрывов» микрокапель

Анализируемое вещество подается в растворе через капилляр с поданым на него напряжением.

Растворители: вода, ацетонитрил, метанол

В результате получаются многозарядные газофазные ионы, захватившие на себя разное количество протонов, вплоть до максимально возможного.

8 MALDI - matrix assisted laser desorption / ionization лазерная

MALDI - matrix assisted laser desorption / ionization лазерная

десорбция и ионизация в присутствии вспомогательного вещества - матрицы

Анализируемое вещество (раствор 10-4 -10-8 М, <1 мкл) смешивается с матрицей (раствор 10-1 -10-2 М, <1 мкл), высушивается на подложке, образуя кристаллоиды

МАТРИЦА: * Поглощает энегрию лазерного излучения, “вскипая”, увлекает в газовую фазу молекулы анализируемого вещества * Способствует ионизации

Матрицы для УФ лазера (336нм)

Лазер: 2нс, 50-300 мкДж/имп , 50мкм

9 Пример MALDI масс-спектра: триптический гидролизат фрагмента белка М1

Пример MALDI масс-спектра: триптический гидролизат фрагмента белка М1

вируса гриппа

MLLTQVQTYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

10 MALDI : типы положительных ионов и вид спектра

MALDI : типы положительных ионов и вид спектра

Точный механизм MALDI ионизации неизвестен, однако в результате образуются, как правило, однозарядные ионы, захватившие протон либо иной катион.

11 Естественное изотопное распределение в белках и пептидах

Естественное изотопное распределение в белках и пептидах

NB: в масс-спектре детектируется 103 – 106 молекул аналита. Этого достаточно для наблюдения изотопного рапределения. Моноизотопная масса – масса пептида, не содержащего ни одного13С

Вид MALDI масс-спектра

Вид ESI масс-спектра

Пептид массой 2000 Д содержит ~ 100 углеродов в нем с вероятностью ~ 30% не встретится 13С, с вероятностью ~ 50% встретится один 13С, с вероятностью ~ 20% встретится два 13С.

Моноизотопнная масса

Средняя (average) масса

12 Замечания о ESI и MALDI:

Замечания о ESI и MALDI:

* Оба метода ионизации требуют высокой химической чистоты анализируемого вещества. * Диапазон концентрации аналита при ESI и MALDI 10-3 – 10-7 M. * Поскольку разные вещества (например, пептиды) обладают разной способностью к ионизации (захвату протона либо другого катиона), то невозможно делать выводы о количественном соотношении компонентов сложной смеси на основании высот пиков в спектре.

ESI является более “мягким” способом ионизации, чем MALDI.

При ESI образуется непрерывный поток ионов, при MALDI - сильно ограниченный во времени (до 10нс) пакет ионов.

При ESI анализу подлежит более 10 фемтомолей вещества, при MALDI - более 1 фемтомоля вещества.

При ESI образуются ионы m/z 0-5000, возможно измерение белков до ~50 000 Да. При MALDI возможно измерение белков до ~200 000 Да, диапазон измеряемых масс ограничен снизу до ~500 Да из-за присутсвия с спектрах пиков матрицы.

13 Системы разделения ионов

Системы разделения ионов

Времяпролетный масс-анализатор

Магнитный анализатор

Квадрупольный анализатор

Ионная ловушка

14 Maldi-времяпролетный масс-спектрометр с MCP детектором

Maldi-времяпролетный масс-спектрометр с MCP детектором

Микроканальные пластины

Энергия ускорения 20 кэВ и длина пути 1м

При MALDI существует разброс по энергиям, приводящий к уширению пиков.

При энергии ускорения 20 кэВ разброс в 100эВ составляет 0.5%. Так пик пептида м.в. 1000Д имел бы ширину на половине высоте около 2 Да !

15 Уменьшение стартового разброса ионов – повышение разрешения

Уменьшение стартового разброса ионов – повышение разрешения

MALDI-TOF-MS

Использование отражающего напряжения (рефлектрона Мамырина)

Использование «отсрочки экстракции»

Вакуум

16 Разрешение и точность MALDI-TOF-MS

Разрешение и точность MALDI-TOF-MS

Разрешение до 30 000, точность до 0.002% (=20ppm).

17 Распад ионов в процессе MALDI

Распад ионов в процессе MALDI

Когда ион, захвативший избыток энергии в процессе MALDI, распадается в области свободного дрейфа, фрагменты имеют ту же скорость, что и их родительский ион, а энергию - меньшую (~ m)

18 PSD (post source decay) и TOF-TOF детекция распада ионов во время

PSD (post source decay) и TOF-TOF детекция распада ионов во время

свободного дрейфа

Для адекватного отражения дочерних ионов: u1ref/u0ref = m1/m0

Точность измерения масс фрагментов 0.02-0.1%

Набор масс-спектров с разным U рефлектрона компьютерно “сшиваются” в один спектр PSD

Получается один спектр фрагментации TOF-TOF

19 ESI – ионная ловушка с МСР детектором

ESI – ионная ловушка с МСР детектором

Ионные ловушки позволяют, варьируя напряжения, оставлять в ловушке определенные ионы и получать спектры их фрагментов. При этом возможен ряд последовательных фрагментаций иона.

Характеристиками ловушки являются: ёмкость (верхнее значение разделяемых m/z ) до 4000, разрешение до 0.2 Да по диапазону, точность до 0.01% (=100ppm) для родительских ионов и фрагментов.

На верхний и нижний электроды подано постоянное положительное напряжение. На короткое время отталкивающее напряжение с верхнего электрода снимается, позволяя пакету ионов влететь в ловушку. На центральном электроде -быстропеременное напряжение, которое заставляет ионы всех m/z двигаться со своими частотами по своим орбитам.

Затем, на экстрагирующие линзы подается осцилируещее напряжение, последовательно вытягивающее ионы согласно их m/z.

Ионная ловушка хорошо сочетается с жидкостным хроматографом.

20 «Гибридные» приборы: ESI – квадруполь – ортогональный времяпролетный

«Гибридные» приборы: ESI – квадруполь – ортогональный времяпролетный

МС

Сочетает хорошее разрешение времяпролетного масс-спектрометра с возможностью хорошего выделения (включением квадруполя) определенных ионов для получения спектров фрагментации.

Точность 0.01-0.03% для родительских ионов и фрагментов

На электроды квадруполя подается переменное напряжение, позволяющее пролетать только резонансным ионам.

Напуск инертного газа приводит к столкновительной фрагментации ионов.

21 ESI - масс-спектрометры ионно-циклотронног резонанса с последующим

ESI - масс-спектрометры ионно-циклотронног резонанса с последующим

Фурье- преобразованием (ICR-FT)

Характеристики ICR-FT : разрешение до 10 000 000, точность до 0.0001% (=1ppm).

Ионы «запираются» в мощный (7-14 тесла) секторный сверхпроводящий магнит, где вращаются под действием силы Лоренца с частотой, зависящей от m/z.

Два сектора магнита используются для снятия токов, наведенных пролетающими мимо них ионами. Сложный сигнал от ионов разных m/z подлежит разложению по частотам (Фурье-преобразованию).

22 Сравнение характеристик приборов

Сравнение характеристик приборов

23 Историческая справка:

Историческая справка:

Cовременный масс-спектрометр основан на работе, сделанной сэром Дж. Томсоном в Кэвендишевской лаборатории Кембриджского университета. Исследования Томсона, приведшие к открытию электрона в 1897 году, также привели к созданию первого масс-спектрометра, построенного им для изучения влияния электрического и магнитного полей на ионы, генерируемые в остаточном газе на катоде рентгеновской трубки. В 1906 году Томсон получил Нобелевскую премию по физике за "Выдающиеся заслуги в теоретическом и экспериментальном изучении электропроводимости газов". К концу Первой мировой войны работы Френсиса Астона и Артура Демпстера привели к значительному улучшению точности и воспроизводимости измерений на масс-спектрометрах. Позднее Альфред Нир воплотил эти достижения вместе со значительным продвижением в вакуумной технике и электронике в конструкцию масс-спектрометра, значительно сократив его размеры. Еще раньше, в 1946 году, Уильям Стивенс предложил концепцию времяпролетных анализаторов. В середине 1950-ых годов Вольфганг Пол разработал квадрупольный масс-анализатор. Другой разработкой Пола было создание квадрупольной ионной ловушки, специально предназначенной для захвата и измерения масс ионов. За свои инновационные работы Вольфганг Пол получил в 1989 году Нобелевскую премию по физике. В 1950-е годы впервые были соединены газовый хроматограф и масс-спектрометр (Голке, Маклаферти и Рихаге). Затем появились новые методы ионизации - бомбардировка быстрыми атомами (Барбер), химическая ионизация (Тальрозе, Филд, Мансон), полевая десорбция/ ионизация (Беки), MALDI (Танака, Карас, Хилленкампф), ESI (Доул, Фенн), ионизация в инуктивно-связанной плазме (Фассел). Были разработаны масс-спектрометры ионно-циклотронного резонанса (Хиппл) и, затем, с Фурье-преобразованием сигнала (Комиссаров, Маршалл), тройные квадрупольные тандемные масс-спектрометры (Йоуст, Энке).

«Масс-спектрометрия в протеомных исследованиях»
http://900igr.net/prezentacija/fizika/mass-spektrometrija-v-proteomnykh-issledovanijakh-97203.html
cсылка на страницу
Урок

Физика

134 темы
Слайды
900igr.net > Презентации по физике > Без темы > Масс-спектрометрия в протеомных исследованиях